PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_01606_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ZF-HD
Protein Properties Length: 237aa    MW: 26602.4 Da    PI: 8.1532
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_01606_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer105.53.3e-3357112359
                 ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                                  vrYkeClkNhAa++Ggh+vDGCgEfmps geegt+aa+kCaAC+CHRnFHR+e + 
  Cotton_A_01606_BGI-A2_v1.0  57 VVRYKECLKNHAATMGGHVVDGCGEFMPS-GEEGTMAAMKCAACECHRNFHRKEING 112
                                 589*************************9.999********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047701.1E-3058110IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257742.0E-2158113IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.0E-3059110IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.38360109IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466892.26E-19167234IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-29169235IPR009057Homeodomain-like
TIGRFAMsTIGR015653.9E-27173230IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MELRDQDKEM GLPLPLSSSQ TPNPRPPQTL NHYPNIDPVP PGSVAGAELE PVGSSLVVRY  60
KECLKNHAAT MGGHVVDGCG EFMPSGEEGT MAAMKCAACE CHRNFHRKEI NGESQYIPPL  120
PRRNGVVHLQ QQPVRFPAPV MMSFGGGGGG TAEESSSEDL RHDELINVPQ SSKKRFRTKF  180
SQDQKEKMME FAETLGWRIQ KQDEHELQMF CSQVGVKRQV FKVWMHNNKQ AMKKKQM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A1e-221722311675ZF-HD homeobox family protein
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012469414.11e-176PREDICTED: zinc-finger homeodomain protein 6-like
SwissprotQ9ZPW71e-67ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLA0A0D2MHX91e-176A0A0D2MHX9_G
STRINGSolyc02g085160.1.16e-74(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65152543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.12e-63homeobox protein 24